Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
BLCAP (англ. Bladder cancer associated protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 87 амінокислот, а молекулярна маса — 9 876.
| BLCAP | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ідентифікатори | |||||||||||||||||
| Символи | BLCAP, BC10, bladder cancer associated protein, apoptosis inducing factor, BLCAP apoptosis inducing factor | ||||||||||||||||
| Зовнішні ІД | OMIM: 613110 MGI: 1858907 HomoloGene: 38217 GeneCards: BLCAP | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 20: 37.49 – 37.53 Mb | Хр. 2: 157.4 – 157.41 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MYCLQWLLPV | LLIPKPLNPA | LWFSHSMFMG | FYLLSFLLER | KPCTICALVF | ||||
| LAALFLICYS | CWGNCFLYHC | SDSPLPESAH | DPGVVGT |
Задіяний у таких біологічних процесах, як апоптоз, клітинний цикл. Локалізований у мембрані.
Література
- Gromova I., Gromov P., Celis J.E. (1999). Identification of true differentially expressed mRNAs in a pair of human bladder transitional cell carcinomas using an improved differential display procedure. Electrophoresis. 20: 241—248. PMID 10197429 DOI:10.1002/(SICI)1522-2683(19990201)20:2<241::AID-ELPS241>3.3.CO;2-1
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zuo Z., Zhao M., Liu J., Gao G., Wu X. (2006). Functional analysis of bladder cancer-related protein gene: a putative cervical cancer tumor suppressor gene in cervical carcinoma. Tumor Biol. 27: 221—226. PMID 16675915 DOI:10.1159/000093057
- Yao J., Duan L., Fan M., Yuan J., Wu X. (2007). Overexpression of BLCAP induces S phase arrest and apoptosis independent of p53 and NF-kappaB in human tongue carcinoma: BLCAP overexpression induces S phase arrest and apoptosis. Mol. Cell. Biochem. 297: 81—92. PMID 17031575 DOI:10.1007/s11010-006-9332-2
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 1 вересня 2015. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 1 жовтня 2016. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BLCAP angl Bladder cancer associated protein bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 87 aminokislot a molekulyarna masa 9 876 BLCAPIdentifikatoriSimvoliBLCAP BC10 bladder cancer associated protein apoptosis inducing factor BLCAP apoptosis inducing factorZovnishni ID OMIM 613110 MGI 1858907 HomoloGene 38217 GeneCards BLCAPOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane membranaBiologichnij proces klitinnij cikl apoptotic nuclear changes GO 0097285 apoptozDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez10904 53619Ensembl ENSG00000166619 ENSMUSG00000067787UniProt P62952 P62951RefSeq mRNK NM 006698 NM 001167820 NM 001167821 NM 001167822 NM 001167823NM 001317074 NM 001317075NM 016916 NM 001355426RefSeq bilok NP 001161292 NP 001161293 NP 001161294 NP 001161295 NP 001304003NP 001304004 NP 006689NP 058612 NP 001342355Lokus UCSC Hr 20 37 49 37 53 MbHr 2 157 4 157 41 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVF LAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak apoptoz klitinnij cikl Lokalizovanij u membrani LiteraturaGromova I Gromov P Celis J E 1999 Identification of true differentially expressed mRNAs in a pair of human bladder transitional cell carcinomas using an improved differential display procedure Electrophoresis 20 241 248 PMID 10197429 DOI 10 1002 SICI 1522 2683 19990201 20 2 lt 241 AID ELPS241 gt 3 3 CO 2 1 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zuo Z Zhao M Liu J Gao G Wu X 2006 Functional analysis of bladder cancer related protein gene a putative cervical cancer tumor suppressor gene in cervical carcinoma Tumor Biol 27 221 226 PMID 16675915 DOI 10 1159 000093057 Yao J Duan L Fan M Yuan J Wu X 2007 Overexpression of BLCAP induces S phase arrest and apoptosis independent of p53 and NF kappaB in human tongue carcinoma BLCAP overexpression induces S phase arrest and apoptosis Mol Cell Biochem 297 81 92 PMID 17031575 DOI 10 1007 s11010 006 9332 2PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 1 veresnya 2015 Procitovano 12 veresnya 2017 angl Arhiv originalu za 1 zhovtnya 2016 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi