BCL10 (англ. B-cell CLL/lymphoma 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 233 амінокислот, а молекулярна маса — 26 252.
BCL10 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BCL10, CARMEN, CIPER, CLAP, c-E10, mE10, IMD37, B-cell CLL/lymphoma 10, B cell CLL/lymphoma 10, immune signaling adaptor, BCL10 immune signaling adaptor | ||||||||||||||||
Зовнішні ІД | OMIM: 603517 MGI: 1337994 HomoloGene: 2912 GeneCards: BCL10 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
MALT lymphoma | |||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 85.27 – 85.28 Mb | Хр. 3: 145.63 – 145.64 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEPTAPSLTE | EDLTEVKKDA | LENLRVYLCE | KIIAERHFDH | LRAKKILSRE | ||||
DTEEISCRTS | SRKRAGKLLD | YLQENPKGLD | TLVESIRREK | TQNFLIQKIT | ||||
DEVLKLRNIK | LEHLKGLKCS | SCEPFPDGAT | NNLSRSNSDE | SNFSEKLRAS | ||||
TVMYHPEGES | STTPFFSTNS | SLNLPVLEVG | RTENTIFSST | TLPRPGDPGA | ||||
PPLPPDLQLE | EEGTCANSSE | MFLPLRSRTV | SRQ |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, імунітет, ацетиляція. Локалізований у цитоплазмі, мембрані.
Література
- Yan M., Lee J., Schilbach S., Goddard A., Dixit V.M. (1999). mE10, a novel caspase recruitment domain-containing proapoptotic molecule. J. Biol. Chem. 274: 10287—10292. PMID 10187815 DOI:10.1074/jbc.274.15.10287
- Costanzo A., Guiet C., Vito P. (1999). c-E10 is a caspase-recruiting domain-containing protein that interacts with components of death receptors signaling pathway and activates nuclear factor-kappaB. J. Biol. Chem. 274: 20127—20132. PMID 10400625 DOI:10.1074/jbc.274.29.20127
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Lobry C., Lopez T., Israel A., Weil R. (2007). Negative feedback loop in T cell activation through IkappaB kinase-induced phosphorylation and degradation of Bcl10. Proc. Natl. Acad. Sci. U.S.A. 104: 908—913. PMID 17213322 DOI:10.1073/pnas.0606982104
- Apostolou S., de Rienzo A., Murthy S.S., Jhanwar S.C., Testa J.R. (1999). Absence of BCL10 mutations in human malignant mesothelioma. Cell. 97: 684—686. PMID 10380921 DOI:10.1016/S0092-8674(02)09765-9
Примітки
- Захворювання, генетично пов'язані з BCL10 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:989 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 5 вересня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BCL10 angl B cell CLL lymphoma 10 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 233 aminokislot a molekulyarna masa 26 252 BCL10Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2MB9IdentifikatoriSimvoliBCL10 CARMEN CIPER CLAP c E10 mE10 IMD37 B cell CLL lymphoma 10 B cell CLL lymphoma 10 immune signaling adaptor BCL10 immune signaling adaptorZovnishni ID OMIM 603517 MGI 1337994 HomoloGene 2912 GeneCards BCL10Pov yazani genetichni zahvoryuvannyaMALT lymphoma Ontologiya genaMolekulyarna funkciya GO 0001105 transcription coactivator activity transcription factor binding protein kinase B binding NF kappaB binding protease binding protein self association kinase binding protein C terminus binding GO 0001948 GO 0016582 protein binding kinase activator activity enzyme binding protein kinase binding ubiquitin protein ligase binding identical protein binding CARD domain bindingKlitinna komponenta citoplazma gialoplazma membrana T cell receptor complex lipopolysaccharide receptor complex immunological synapse perinuclear region of cytoplasm membrane raft cytoplasmic microtubule lizosoma klitinne yadro CBM complex GO 0009327 protein containing complexBiologichnij proces GO 0097285 apoptoz T cell apoptotic process regulation of apoptotic process adaptivna imunna vidpovid B cell apoptotic process regulation of T cell receptor signaling pathway proces imunnoyi sistemi smert klitini stimulatory C type lectin receptor signaling pathway negative regulation of mature B cell apoptotic process toll like receptor signaling pathway GO 0060469 GO 0009371 positive regulation of transcription DNA templated Fc epsilon receptor signaling pathway cellular defense response positive regulation of cysteine type endopeptidase activity involved in apoptotic process cellular response to mechanical stimulus neural tube closure response to fungus positive regulation of T cell activation positive regulation of NF kappaB transcription factor activity immunoglobulin mediated immune response protein complex oligomerization positive regulation of mast cell cytokine production response to food positive regulation of I kappaB kinase NF kappaB signaling positive regulation of extrinsic apoptotic signaling pathway positive regulation of phosphorylation response to molecule of bacterial origin I kappaB kinase NF kappaB signaling positive regulation of protein ubiquitination T cell receptor signaling pathway protein homooligomerization vrodzhenij imunitet Ubikvitin zalezhnij proteoliz positive regulation of apoptotic process protein heterooligomerization lipopolysaccharide mediated signaling pathway positive regulation of kinase activityDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez8915 12042Ensembl ENSG00000142867 ENSMUSG00000028191UniProt O95999 Q9Z0H7RefSeq mRNK NM 003921 NM 001320715NM 009740RefSeq bilok NP 001307644 NP 003912 NP 001307644 1NP 033870Lokus UCSC Hr 1 85 27 85 28 MbHr 3 145 63 145 64 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSRE DTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKIT DEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRAS TVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGA PPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz imunitet acetilyaciya Lokalizovanij u citoplazmi membrani LiteraturaYan M Lee J Schilbach S Goddard A Dixit V M 1999 mE10 a novel caspase recruitment domain containing proapoptotic molecule J Biol Chem 274 10287 10292 PMID 10187815 DOI 10 1074 jbc 274 15 10287 Costanzo A Guiet C Vito P 1999 c E10 is a caspase recruiting domain containing protein that interacts with components of death receptors signaling pathway and activates nuclear factor kappaB J Biol Chem 274 20127 20132 PMID 10400625 DOI 10 1074 jbc 274 29 20127 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Lobry C Lopez T Israel A Weil R 2007 Negative feedback loop in T cell activation through IkappaB kinase induced phosphorylation and degradation of Bcl10 Proc Natl Acad Sci U S A 104 908 913 PMID 17213322 DOI 10 1073 pnas 0606982104 Apostolou S de Rienzo A Murthy S S Jhanwar S C Testa J R 1999 Absence of BCL10 mutations in human malignant mesothelioma Cell 97 684 686 PMID 10380921 DOI 10 1016 S0092 8674 02 09765 9PrimitkiZahvoryuvannya genetichno pov yazani z BCL10 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 989 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 5 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi