Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CCND1 англ Cyclin D1 білок який кодується однойменним геном розташованим у людей на короткому плечі 11 ї хромосоми Довжи

Циклін D1

Циклін D1

CCND1 (англ. Cyclin D1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 295 амінокислот, а молекулярна маса — 33 729.

CCND1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CCND1, BCL1, D11S287E, PRAD1, U21B31, cyclin D1
Зовнішні ІД OMIM: 168461 MGI: 88313 HomoloGene: 1334 GeneCards: CCND1
Пов'язані генетичні захворювання
мієломна хвороба
Реагує на сполуку
palbociclib
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
595
12443
Ensembl
ENSG00000110092
ENSMUSG00000070348
UniProt
P24385
P25322
RefSeq (мРНК)
NM_053056
NM_007631
NM_001379248
RefSeq (білок)
NP_444284
NP_031657
NP_001366177
Локус (UCSC) Хр. 11: 69.64 – 69.65 Mb Хр. 7: 144.48 – 144.49 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQK
EVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQ
LLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKW
NLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPP
SMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQ
IEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, поділ клітини, пошкодження ДНК. Локалізований у цитоплазмі, ядрі, мембрані.

Література

  • Lew D.J., Dulic V., Reed S.I. (1991). Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast. Cell. 66: 1197—1206. PMID 1833066 DOI:10.1016/0092-8674(91)90042-W
  • Xiong Y., Connolly T., Futcher B., Beach D. (1991). Human D-type cyclin. Cell. 65: 691—699. PMID 1827756 DOI:10.1016/0092-8674(91)90100-D
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Motokura T., Arnold A. (1993). The PRAD1/cyclin D1 proto-oncogene: genomic organization, 5' DNA sequence, and sequence of a tumor-specific rearrangement breakpoint. Genes Chromosomes Cancer. 7: 89—95. PMID 7687458 DOI:10.1002/gcc.2870070205
  • Germain D., Russell A., Thompson A., Hendley J. (2000). Ubiquitination of free cyclin D1 is independent of phosphorylation on threonine 286. J. Biol. Chem. 275: 12074—12079. PMID 10766840 DOI:10.1074/jbc.275.16.12074
  • Liu W.D., Wang H.W., Muguira M., Breslin M.B., Lan M.S. (2006). INSM1 functions as a transcriptional repressor of the neuroD/beta2 gene through the recruitment of cyclin D1 and histone deacetylases. Biochem. J. 397: 169—177. PMID 16569215 DOI:10.1042/BJ20051669

Примітки

  1. Захворювання, генетично пов'язані з CCND1 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Cyclin D1 переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:1582 (англ.) . Процитовано 8 вересня 2017.
  6. UniProt, P24385 (англ.) . Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CCND1 angl Cyclin D1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 295 aminokislot a molekulyarna masa 33 729 CCND1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2W96 2W99 2W9F 2W9ZIdentifikatoriSimvoliCCND1 BCL1 D11S287E PRAD1 U21B31 cyclin D1Zovnishni ID OMIM 168461 MGI 88313 HomoloGene 1334 GeneCards CCND1Pov yazani genetichni zahvoryuvannyamiyelomna hvoroba Reaguye na spolukupalbociclib Ontologiya genaMolekulyarna funkciya protein kinase activity GO 0001106 transcription corepressor activity transcription factor binding histone deacetylase binding kinase activity cyclin dependent protein serine threonine kinase regulator activity GO 0001948 GO 0016582 protein binding enzyme binding proline rich region binding protein kinase binding cyclin dependent protein serine threonine kinase activity GO 0032403 protein containing complex bindingKlitinna komponenta citoplazma gialoplazma cyclin dependent protein kinase holoenzyme complex membrana bicellular tight junction transcription repressor complex vnutrishnoklitinnij nukleoplazma klitinne yadroBiologichnij proces cellular response to organic substance mammary gland epithelial cell proliferation positive regulation of mammary gland epithelial cell proliferation response to estradiol positive regulation of protein phosphorylation Leydig cell differentiation GO 0009373 regulation of transcription DNA templated GO 1904578 response to organic cyclic compound response to steroid hormone response to corticosterone negative regulation of Wnt signaling pathway response to magnesium ion response to glucocorticoid re entry into mitotic cell cycle GO 1901227 negative regulation of transcription by RNA polymerase II Wnt signaling pathway mammary gland alveolus development response to organic substance transcription DNA templated response to vitamin E regulation of cell cycle response to iron ion response to estrogen response to calcium ion podil klitini cellular response to DNA damage stimulus Vidpovid na nezgornuti bilki protein phosphorylation regulation of G1 S transition of mitotic cell cycle liver regeneration mitotic G1 DNA damage checkpoint signaling animal organ regeneration response to organonitrogen compound positive regulation of cell population proliferation positive regulation of cyclin dependent protein serine threonine kinase activity canonical Wnt signaling pathway response to UV A klitinnij cikl liver development positive regulation of G2 M transition of mitotic cell cycle laktaciya response to ethanol response to leptin negative regulation of epithelial cell differentiation fat cell differentiation response to X ray positive regulation of cell cycle transcription initiation from RNA polymerase II promoter G1 S transition of mitotic cell cycle cytokine mediated signaling pathway positive regulation of epithelial cell proliferation regulation of cyclin dependent protein serine threonine kinase activity GO 0007067 mitoz regulation of mitotic nuclear division positive regulation of G1 S transition of mitotic cell cycleDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez595 12443Ensembl ENSG00000110092 ENSMUSG00000070348UniProt P24385 P25322RefSeq mRNK NM 053056NM 007631 NM 001379248RefSeq bilok NP 444284NP 031657 NP 001366177Lokus UCSC Hr 11 69 64 69 65 MbHr 7 144 48 144 49 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQK EVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQ LLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKW NLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPP SMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQ IEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi klitinnij cikl podil klitini poshkodzhennya DNK Lokalizovanij u citoplazmi yadri membrani LiteraturaLew D J Dulic V Reed S I 1991 Isolation of three novel human cyclins by rescue of G1 cyclin Cln function in yeast Cell 66 1197 1206 PMID 1833066 DOI 10 1016 0092 8674 91 90042 W Xiong Y Connolly T Futcher B Beach D 1991 Human D type cyclin Cell 65 691 699 PMID 1827756 DOI 10 1016 0092 8674 91 90100 D The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Motokura T Arnold A 1993 The PRAD1 cyclin D1 proto oncogene genomic organization 5 DNA sequence and sequence of a tumor specific rearrangement breakpoint Genes Chromosomes Cancer 7 89 95 PMID 7687458 DOI 10 1002 gcc 2870070205 Germain D Russell A Thompson A Hendley J 2000 Ubiquitination of free cyclin D1 is independent of phosphorylation on threonine 286 J Biol Chem 275 12074 12079 PMID 10766840 DOI 10 1074 jbc 275 16 12074 Liu W D Wang H W Muguira M Breslin M B Lan M S 2006 INSM1 functions as a transcriptional repressor of the neuroD beta2 gene through the recruitment of cyclin D1 and histone deacetylases Biochem J 397 169 177 PMID 16569215 DOI 10 1042 BJ20051669PrimitkiZahvoryuvannya genetichno pov yazani z CCND1 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Cyclin D1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1582 angl Procitovano 8 veresnya 2017 UniProt P24385 angl Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ