Глутатіон-S-трансфераза P (англ. Glutathione S-transferase pi 1) – білок, який кодується геном GSTP1, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 210 амінокислот, а молекулярна маса — 23 356.
Глутатіон-S-трансфераза P | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | GSTP1, DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI, glutathione S-transferase pi 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 134660 MGI: 3782108 HomoloGene: 660 GeneCards: GSTP1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 67.58 – 67.59 Mb | н/д | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MPPYTVVYFP | VRGRCAALRM | LLADQGQSWK | EEVVTVETWQ | EGSLKASCLY | ||||
GQLPKFQDGD | LTLYQSNTIL | RHLGRTLGLY | GKDQQEAALV | DMVNDGVEDL | ||||
RCKYISLIYT | NYEAGKDDYV | KALPGQLKPF | ETLLSQNQGG | KTFIVGDQIS | ||||
FADYNLLDLL | LIHEVLAPGC | LDAFPLLSAY | VGRLSARPKL | KAFLASPEYV | ||||
NLPINGNGKQ |
Цей білок за функцією належить до трансфераз. Локалізований у цитоплазмі, ядрі, мітохондрії.
Література
- Cowell I.G., Dixon K.H., Pemble S.E., Ketterer B., Taylor J.B. (1988). The structure of the human glutathione S-transferase pi gene. Biochem. J. 255: 79—83. PMID 3196325 DOI:10.1042/bj2550079
- Morrow C.S., Cowan K.H., Goldsmith M.E. (1989). Structure of the human genomic glutathione S-transferase-pi gene. Gene. 75: 3—11. PMID 2542132 DOI:10.1016/0378-1119(89)90377-6
- Ali-Osman F., Akande O., Antoun G., Mao J.X., Buolamwini J. (1997). Molecular cloning, characterization, and expression in Escherichia coli of full-length cDNAs of three human glutathione S-transferase Pi gene variants. Evidence for differential catalytic activity of the encoded proteins. J. Biol. Chem. 272: 10004—10012. PMID 9092542 DOI:10.1074/jbc.272.15.10004
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Alin P., Mannervik B., Joernvall H. (1985). Structural evidence for three different types of glutathione transferase in human tissues. FEBS Lett. 182: 319—322. PMID 3979555 DOI:10.1016/0014-5793(85)80324-0
- Singh S.V., Ahmad H., Kurosky A., Awasthi Y.C. (1988). Purification and characterization of unique glutathione S-transferases from human muscle. Arch. Biochem. Biophys. 264: 13—22. PMID 3395118 DOI:10.1016/0003-9861(88)90564-4
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4638 (англ.) . Процитовано 6 лютого 2017.
{{}}
: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P09211 (англ.) . Архів оригіналу за 20 березня 2017. Процитовано 6 лютого 2017.
Див. також
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
Glutation S transferaza P angl Glutathione S transferase pi 1 bilok yakij koduyetsya genom GSTP1 roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 210 aminokislot a molekulyarna masa 23 356 4 Glutation S transferaza PNayavni strukturiPDBPoshuk dlya lyudej PDBe RCSB Spisok kodiv PDB10GS 11GS 12GS 13GS 14GS 16GS 17GS 18GS 19GS 1AQV 1AQW 1AQX 1EOG 1EOH 1GSS 1KBN 1LBK 1MD3 1MD4 1PGT 1PX6 1PX7 1ZGN 20GS 22GS 2A2R 2A2S 2GSS 2J9H 2PGT 3CSH 3CSI 3CSJ 3DD3 3DGQ 3GSS 3GUS 3HJM 3HJO 3HKR 3IE3 3KM6 3KMN 3KMO 3N9J 3PGT 4GSS 4PGT 5GSS 6GSS 7GSS 8GSS 9GSSIdentifikatoriSimvoliGSTP1 DFN7 FAEES3 GST3 GSTP HEL S 22 PI glutathione S transferase pi 1Zovnishni ID OMIM 134660 MGI 3782108 HomoloGene 660 GeneCards GSTP1Ontologiya genaMolekulyarna funkciya transferase activity JUN kinase binding kinase regulator activity glutathione binding nitric oxide binding GO 0001948 GO 0016582 protein binding S nitrosoglutathione binding dinitrosyl iron complex binding glutathione transferase activity protein kinase binding glutathione peroxidase activityKlitinna komponenta vezikula TRAF2 GSTP1 complex klitinna membrana vnutrishnoklitinnij mitohondriya ekzosoma klitinne yadro extracellular region mizhklitinnij prostir citoplazma gialoplazma secretory granule lumen ficolin 1 rich granule lumenBiologichnij proces negative regulation of monocyte chemotactic protein 1 production cellular response to cell matrix adhesion response to amino acid response to estradiol negative regulation of interleukin 1 beta production negative regulation of acute inflammatory response glutathione metabolic process negative regulation of tumor necrosis factor mediated signaling pathway negative regulation of leukocyte proliferation common myeloid progenitor cell proliferation nitric oxide storage negative regulation of extrinsic apoptotic signaling pathway negative regulation of apoptotic process response to L ascorbic acid negative regulation of I kappaB kinase NF kappaB signaling cellular response to epidermal growth factor stimulus central nervous system development cellular response to glucocorticoid stimulus response to nutrient levels negative regulation of MAP kinase activity animal organ regeneration regulation of ERK1 and ERK2 cascade cellular response to insulin stimulus negative regulation of MAPK cascade negative regulation of ERK1 and ERK2 cascade negative regulation of stress activated MAPK cascade oligodendrocyte development positive regulation of superoxide anion generation negative regulation of tumor necrosis factor production obmin rechovin response to ethanol cellular response to lipopolysaccharide negative regulation of JUN kinase activity negative regulation of fibroblast proliferation negative regulation of nitric oxide synthase biosynthetic process glutathione derivative biosynthetic process response to toxic substance regulation of stress activated MAPK cascade negative regulation of biosynthetic process cellular oxidant detoxification negative regulation of protein kinase activity xenobiotic metabolic process negative regulation of smooth muscle cell chemotaxis linoleic acid metabolic process negative regulation of vascular associated smooth muscle cell proliferation neutrophil degranulation GO 0001315 response to reactive oxygen species cellular response to oxidative stress xenobiotic catabolic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2950 100042625Ensembl ENSG00000084207 n dUniProt P09211 n dRefSeq mRNK NM 000852XM 036155425RefSeq bilok NP 000843n dLokus UCSC Hr 11 67 58 67 59 Mbn dPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLY GQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDL RCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQIS FADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYV NLPINGNGKQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Cej bilok za funkciyeyu nalezhit do transferaz Lokalizovanij u citoplazmi yadri mitohondriyi Literaturared Cowell I G Dixon K H Pemble S E Ketterer B Taylor J B 1988 The structure of the human glutathione S transferase pi gene Biochem J 255 79 83 PMID 3196325 DOI 10 1042 bj2550079 Morrow C S Cowan K H Goldsmith M E 1989 Structure of the human genomic glutathione S transferase pi gene Gene 75 3 11 PMID 2542132 DOI 10 1016 0378 1119 89 90377 6 Ali Osman F Akande O Antoun G Mao J X Buolamwini J 1997 Molecular cloning characterization and expression in Escherichia coli of full length cDNAs of three human glutathione S transferase Pi gene variants Evidence for differential catalytic activity of the encoded proteins J Biol Chem 272 10004 10012 PMID 9092542 DOI 10 1074 jbc 272 15 10004 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Alin P Mannervik B Joernvall H 1985 Structural evidence for three different types of glutathione transferase in human tissues FEBS Lett 182 319 322 PMID 3979555 DOI 10 1016 0014 5793 85 80324 0 Singh S V Ahmad H Kurosky A Awasthi Y C 1988 Purification and characterization of unique glutathione S transferases from human muscle Arch Biochem Biophys 264 13 22 PMID 3395118 DOI 10 1016 0003 9861 88 90564 4Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4638 angl Procitovano 6 lyutogo 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P09211 angl Arhiv originalu za 20 bereznya 2017 Procitovano 6 lyutogo 2017 Div takozhred Hromosoma 11 Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Glutation S transferaza P amp oldid 43517179