COX2 (англ. Cytochrome c oxidase subunit II) – білок, який кодується однойменним геном, який у людей є частиною мітохондріальної ДНК. Довжина поліпептидного ланцюга білка становить 227 амінокислот, а молекулярна маса — 25 565.
COX2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | COX2, mitochondrially encoded cytochrome c oxidase II, COII, MTCO2, Cytochrome c oxidase subunit II, CO II | ||||||||||||||||
Зовнішні ІД | OMIM: 516040 MGI: 102503 HomoloGene: 5017 GeneCards: COX2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
cytochrome-c oxidase deficiency disease | |||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | н/д | н/д | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAHAAQVGLQ | DATSPIMEEL | ITFHDHALMI | IFLICFLVLY | ALFLTLTTKL | ||||
TNTNISDAQE | METVWTILPA | IILVLIALPS | LRILYMTDEV | NDPSLTIKSI | ||||
GHQWYWTYEY | TDYGGLIFNS | YMLPPLFLEP | GDLRLLDVDN | RVVLPIEAPI | ||||
RMMITSQDVL | HSWAVPTLGL | KTDAIPGRLN | QTTFTATRPG | VYYGQCSEIC | ||||
GANHSFMPIV | LELIPLKIFE | MGPVFTL |
Задіяний у таких біологічних процесах, як транспорт, транспорт електронів, дихальний ланцюг. Білок має сайт для зв'язування з іоном міді, іонами металів. Локалізований у мембрані, мітохондрії, внутрішній мембрані мітохондрії.
Література
- Power M.D., Kiefer M.C., Barr P.J., Reeves R. (1989). Nucleotide sequence of human mitochondrial cytochrome c oxidase II cDNA. Nucleic Acids Res. 17: 6734—6734. PMID 2550900 DOI:10.1093/nar/17.16.6734
- Barrell B.G., Bankier A.T., Drouin J. (1979). A different genetic code in human mitochondria. Nature. 282: 189—194. PMID 226894 DOI:10.1038/282189a0
- Horai S., Hayasaka K., Kondo R., Tsugane K., Takahata N. (1995). Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. Proc. Natl. Acad. Sci. U.S.A. 92: 532—536. PMID 7530363 DOI:10.1073/pnas.92.2.532
- Moilanen J.S., Finnila S., Majamaa K. (2003). Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J. Mol. Biol. Evol. 20: 2132—2142. PMID 12949126 DOI:10.1093/molbev/msg230
- Ingman M., Kaessmann H., Paeaebo S., Gyllensten U. (2000). Mitochondrial genome variation and the origin of modern humans. Nature. 408: 708—713. PMID 11130070 DOI:10.1038/35047064
- Ingman M., Gyllensten U. (2003). Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines. Genome Res. 13: 1600—1606. PMID 12840039 DOI:10.1101/gr.686603
Примітки
- Захворювання, генетично пов'язані з COX2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:7421 (англ.) . Процитовано 12 вересня 2017.
- UniProt, P00403 (англ.) . Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
COX2 angl Cytochrome c oxidase subunit II bilok yakij koduyetsya odnojmennim genom yakij u lyudej ye chastinoyu mitohondrialnoyi DNK Dovzhina polipeptidnogo lancyuga bilka stanovit 227 aminokislot a molekulyarna masa 25 565 COX2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3VRJIdentifikatoriSimvoliCOX2 mitochondrially encoded cytochrome c oxidase II COII MTCO2 Cytochrome c oxidase subunit II CO IIZovnishni ID OMIM 516040 MGI 102503 HomoloGene 5017 GeneCards COX2Pov yazani genetichni zahvoryuvannyacytochrome c oxidase deficiency disease Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding zv yazuvannya z ionom metalu copper ion binding oxidoreductase activity cytochrome c oxidase activityKlitinna komponenta respiratory chain complex IV respirasome integral component of membrane mitohondriya membrana ekzosoma mitochondrial respiratory chain complex IV mitohondrialna vnutrishnya membranaBiologichnij proces Elektrontransportnij lancyug response to cold laktaciya proton transmembrane transport mitochondrial electron transport cytochrome c to oxygen ATP synthesis coupled electron transport positive regulation of hydrogen peroxide biosynthetic process positive regulation of necrotic cell death positive regulation of ATP biosynthetic processDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez4513 17709Ensembl ENSG00000198712 ENSMUSG00000064354UniProt P00403 P00405RefSeq mRNK n dn dRefSeq bilok n dNP 904331Lokus UCSC n dn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKL TNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSI GHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPI RMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEIC GANHSFMPIVLELIPLKIFEMGPVFTL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak transport transport elektroniv dihalnij lancyug Bilok maye sajt dlya zv yazuvannya z ionom midi ionami metaliv Lokalizovanij u membrani mitohondriyi vnutrishnij membrani mitohondriyi LiteraturaPower M D Kiefer M C Barr P J Reeves R 1989 Nucleotide sequence of human mitochondrial cytochrome c oxidase II cDNA Nucleic Acids Res 17 6734 6734 PMID 2550900 DOI 10 1093 nar 17 16 6734 Barrell B G Bankier A T Drouin J 1979 A different genetic code in human mitochondria Nature 282 189 194 PMID 226894 DOI 10 1038 282189a0 Horai S Hayasaka K Kondo R Tsugane K Takahata N 1995 Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs Proc Natl Acad Sci U S A 92 532 536 PMID 7530363 DOI 10 1073 pnas 92 2 532 Moilanen J S Finnila S Majamaa K 2003 Lineage specific selection in human mtDNA lack of polymorphisms in a segment of MTND5 gene in haplogroup J Mol Biol Evol 20 2132 2142 PMID 12949126 DOI 10 1093 molbev msg230 Ingman M Kaessmann H Paeaebo S Gyllensten U 2000 Mitochondrial genome variation and the origin of modern humans Nature 408 708 713 PMID 11130070 DOI 10 1038 35047064 Ingman M Gyllensten U 2003 Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines Genome Res 13 1600 1606 PMID 12840039 DOI 10 1101 gr 686603PrimitkiZahvoryuvannya genetichno pov yazani z COX2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7421 angl Procitovano 12 veresnya 2017 UniProt P00403 angl Procitovano 12 veresnya 2017 Div takozhMitohondrialna DNK Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi