Підтримка
www.wikidata.uk-ua.nina.az
Termogenin takozh UCP1 angl Uncoupling protein 1 bilok yakij koduyetsya genom UCP1 roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 307 aminokislot a molekulyarna masa 33 005 UCP1IdentifikatoriSimvoliUCP1 SLC25A7 UCP uncoupling protein 1Zovnishni ID OMIM 113730 MGI 98894 HomoloGene 22524 GeneCards UCP1Ontologiya genaMolekulyarna funkciya GO 0022891 transmembrane transporter activity purine ribonucleotide binding long chain fatty acid binding cardiolipin binding oxidative phosphorylation uncoupler activityKlitinna komponenta mitohondrialna obolonka membrana mitohondriya mitohondrialna membrana mitohondrialna vnutrishnya membrana integral component of membraneBiologichnij proces GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II brown fat cell differentiation diet induced thermogenesis ion transport response to temperature stimulus response to nutrient levels cellular response to hormone stimulus GO 0072353 cellular response to reactive oxygen species cellular response to fatty acid regulation of reactive oxygen species biosynthetic process response to cold mitochondrial transmembrane transport adaptive thermogenesis mitochondrial transport proton transmembrane transport positive regulation of cold induced thermogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7350 22227Ensembl ENSG00000109424 ENSMUSG00000031710UniProt P25874 P12242RefSeq mRNK NM 021833NM 009463RefSeq bilok NP 068605NP 033489Lokus UCSC Hr 4 140 56 140 57 MbHr 8 84 02 84 03 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTS SVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQ EFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGI KPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKE AFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKS VPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR QTMDCAT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do ionnih kanaliv sho propuskayut protoni Termogenin lokalizovanij u vnutrishnij membrani mitohondriyi Osnovna fiziologichna rol bilka generuvati teplo v procesi neskorotlivogo termogenezu LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hoang T Smith M D Jelokhani Niaraki M 2013 Expression folding and proton transport activity of human uncoupling protein 1 UCP1 in lipid membranes evidence for associated functional forms J Biol Chem 288 36244 36258 PMID 24196960 DOI 10 1074 jbc M113 509935 Palmieri F 2013 The mitochondrial transporter family SLC25 identification properties and physiopathology Mol Aspects Med 34 465 484 PMID 23266187 DOI 10 1016 j mam 2012 05 005PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12517 angl Procitovano 30 serpnya 2017 UniProt P25874 angl Procitovano 30 serpnya 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi
Топ