DRD1 angl Dopamine receptor D1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 446 aminokislot a molekulyarna masa 49 293 DRD1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1OZ5IdentifikatoriSimvoliDRD1 dopamine receptor D1 DADR DRD1AZovnishni ID OMIM 126449 MGI 99578 HomoloGene 30992 GeneCards DRD1Reaguye na spolukuA 68930 apomorfin kabergolin dofamin fenoldopam pergolide rotigotin Serotonin bromokriptin lisuride SKF 38393 butaclamol hlorpromazin klozapin ecopipam flyupentiksol Flufenazin galoperidol ketanserin mesoridazine prohlorperazin SCH 23390 spiperone tioridazin tavapadon pimozid fenoldopam pergolide mesylate Ontologiya genaMolekulyarna funkciya dopamine neurotransmitter receptor activity dopamine binding GO 0001948 GO 0016582 protein binding dopamine neurotransmitter receptor activity coupled via Gs G protein coupled receptor activity signal transducer activity G protein alpha subunit bindingKlitinna komponenta membrana klitinne yadro endoplazmatichnij retikulum integral component of membrane klitinna membrana endoplasmic reticulum membrane integral component of plasma membrane ciliary membrane sistema endomembran non motile cilium glutamatergic synapse GABA ergic synapse integral component of postsynaptic membrane integral component of presynaptic membrane dendritic spine dendrit nejrobiologiya cell projection vijkaBiologichnij proces positive regulation of cytosolic calcium ion concentration involved in phospholipase C activating G protein coupled signaling pathway m yazove skorochennya protein import into nucleus positive regulation of potassium ion transport response to amphetamine navchennya harchova povedinka Dovgotrivale prignichennya temperature homeostasis striatum development prepulse inhibition response to cocaine marafet behavioral response to cocaine locomotory behavior dentate gyrus development transmission of nerve impulse pam yat positive regulation of synaptic transmission glutamatergic synapse assembly Zvikannya adult walking behavior peristaltika cellular response to catecholamine stimulus adenylate cyclase activating dopamine receptor signaling pathway regulation of dopamine uptake involved in synaptic transmission associative learning astrocyte development G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger positive regulation of release of sequestered calcium ion into cytosol povedinka v chasi sparyuvannya behavioral fear response activation of adenylate cyclase activity dopamine receptor signaling pathway conditioned taste aversion cerebral cortex GABAergic interneuron migration glucose import visual learning sensitization positive regulation of cell migration operantne obumovlennya vazodilataciya regulation of dopamine metabolic process dopamine metabolic process phospholipase C activating dopamine receptor signaling pathway maternal behavior dopamine transport hippocampus development neuronal action potential dovgotrivala potenciaciya GO 0072468 signalna transdukciya synaptic transmission dopaminergic GO 1901313 positive regulation of gene expression cellular response to dopamine regulation of protein phosphorylation G protein coupled receptor signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway regulation of synaptic vesicle exocytosisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1812 13488Ensembl ENSG00000184845 ENSMUSG00000021478UniProt P21728 Q61616RefSeq mRNK NM 000794NM 001291801 NM 010076RefSeq bilok NP 000785NP 001278730 NP 034206Lokus UCSC Hr 5 175 44 175 44 MbHr 13 54 21 54 21 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIR FRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWV AFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTL SVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSV ISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKP VECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRL CPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSED LKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv Zadiyanij u takomu biologichnomu procesi yak polimorfizm Lokalizovanij u klitinnij membrani membrani endoplazmatichnomu retikulumi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Jin H Xie Z George S R O Dowd B F 1999 Palmitoylation occurs at cysteine 347 and cysteine 351 of the dopamine D 1 receptor Eur J Pharmacol 386 305 312 PMID 10618483 DOI 10 1016 S0014 2999 99 00727 XPrimitkiSpoluki yaki fizichno vzayemodiyut z Dopamine receptor D1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3020 angl Procitovano 31 serpnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 31 serpnya 2017 Div takozhHromosoma 5 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi