S100A1 (англ. S100 calcium binding protein A1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 94 амінокислот, а молекулярна маса — 10 546.
S100A1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | S100A1, S100, S100-alpha, S100A, S100 calcium-binding protein A1, S100 calcium binding protein A1 | ||||||||||||||||
Зовнішні ІД | OMIM: 176940 MGI: 1338917 HomoloGene: 4566 GeneCards: S100A1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 153.63 – 153.63 Mb | Хр. 3: 90.42 – 90.42 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGSELETAME | TLINVFHAHS | GKEGDKYKLS | KKELKELLQT | ELSGFLDAQK | ||||
DVDAVDKVMK | ELDENGDGEV | DFQEYVVLVA | ALTVACNNFF | WENS |
Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у цитоплазмі.
Література
- Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W. (1992). S100 alpha, CAPL, and CACY: molecular cloning and expression analysis of three calcium-binding proteins from human heart. Biochemistry. 31: 10258—10264. PMID 1384693 DOI:10.1021/bi00157a012
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. (2002). CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. 277: 28848—28852. PMID 12042313 DOI:10.1074/jbc.M203602200
- Shimamoto S., Kubota Y., Tokumitsu H., Kobayashi R. (2010). S100 proteins regulate the interaction of Hsp90 with cyclophilin 40 and FKBP52 through their tetratricopeptide repeats. FEBS Lett. 584: 1119—1125. PMID 20188096 DOI:10.1016/j.febslet.2010.02.055
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 26 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
S100A1 angl S100 calcium binding protein A1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 94 aminokislot a molekulyarna masa 10 546 S100A1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2L0P 2LHL 2LLS 2LLT 2LLU 2LP2 2LP3 2LUX 2M3WIdentifikatoriSimvoliS100A1 S100 S100 alpha S100A S100 calcium binding protein A1 S100 calcium binding protein A1Zovnishni ID OMIM 176940 MGI 1338917 HomoloGene 4566 GeneCards S100A1Ontologiya genaMolekulyarna funkciya calcium ion binding S100 protein binding protein homodimerization activity ATPase binding calcium dependent protein binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding identical protein bindingKlitinna komponenta citoplazma M band I band sarcoplasmic reticulum Z disc neuron projection A band klitinne yadro extracellular region GO 0009327 protein containing complexBiologichnij proces GO 0007243 intracellular signal transduction regulation of heart contraction substantia nigra development positive regulation of voltage gated calcium channel activity GO 1901227 negative regulation of transcription by RNA polymerase II toll like receptor signaling pathway positive regulation of nitric oxide synthase activity positive regulation of sprouting angiogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6271 20193Ensembl ENSG00000160678 ENSMUSG00000044080UniProt P23297 P56565RefSeq mRNK NM 006271NM 011309RefSeq bilok NP 006262NP 035439Lokus UCSC Hr 1 153 63 153 63 MbHr 3 90 42 90 42 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQK DVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin Q Glutamin S Serin T Treonin V Valin W Triptofan Y Tirozin Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom kalciyu Lokalizovanij u citoplazmi LiteraturaEngelkamp D Schaefer B W Erne P Heizmann C W 1992 S100 alpha CAPL and CACY molecular cloning and expression analysis of three calcium binding proteins from human heart Biochemistry 31 10258 10264 PMID 1384693 DOI 10 1021 bi00157a012 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Filipek A Jastrzebska B Nowotny M Kuznicki J 2002 CacyBP SIP a calcyclin and Siah 1 interacting protein binds EF hand proteins of the S100 family J Biol Chem 277 28848 28852 PMID 12042313 DOI 10 1074 jbc M203602200 Shimamoto S Kubota Y Tokumitsu H Kobayashi R 2010 S100 proteins regulate the interaction of Hsp90 with cyclophilin 40 and FKBP52 through their tetratricopeptide repeats FEBS Lett 584 1119 1125 PMID 20188096 DOI 10 1016 j febslet 2010 02 055PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 23 veresnya 2017 Procitovano 25 serpnya 2017 angl Arhiv originalu za 26 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi