Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CD24 англ CD24 molecule білок який кодується однойменним геном розташованим у людей на короткому плечі 6 ї хромосоми Дов

CD24

CD24

CD24 (англ. CD24 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 80 амінокислот, а молекулярна маса — 8 097.

CD24
Ідентифікатори
Символи CD24, CD24A, CD24 molecule
Зовнішні ІД OMIM: 600074 MGI: 88323 GeneCards: CD24
Ортологи
Види Людина Миша
Entrez
100133941
12484
Ensembl
ENSG00000272398
ENSMUSG00000047139
UniProt
P25063
P24807
RefSeq (мРНК)
NM_001291737
NM_001291738
NM_001291739
NM_013230
NM_001359084
NM_009846
RefSeq (білок)
NP_001278666
NP_001278667
NP_001278668
NP_037362
NP_001346013
NP_033976
Локус (UCSC) Хр. 6: 106.97 – 106.98 Mb Хр. 10: 43.45 – 43.46 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNTGLAPNP
TNATTKAAGGALQSTASLFVVSLSLLHLYS

Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hough M.R., Rosten P.M., Sexton T.L., Kay R., Humphries R.K. (1994). Mapping of CD24 and homologous sequences to multiple chromosomal loci. Genomics. 22: 154—161. PMID 7959762 DOI:10.1006/geno.1994.1356
  • Zarn J.A., Zimmermann S.M., Pass M.K., Waibel R., Stahel R.A. (1996). Association of CD24 with the kinase c-fgr in a small cell lung cancer cell line and with the kinase lyn in an erythroleukemia cell line. Biochem. Biophys. Res. Commun. 225: 384—391. PMID 8753773 DOI:10.1006/bbrc.1996.1184
  • Kay R., Rosten P.M., Humphries R.K. (1991). CD24, a signal transducer modulating B cell activation responses, is a very short peptide with a glycosyl phosphatidylinositol membrane anchor. J. Immunol. 147: 1412—1416. PMID 1831224
  • Jackson D., Waibel R., Weber E., Bell J., Stahel R.A. (1992). CD24, a signal-transducing molecule expressed on human B cells, is a major surface antigen on small cell lung carcinomas. Cancer Res. 52: 5264—5270. PMID 1327504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1645 (англ.) . Процитовано 6 вересня 2017.
  4. (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 6 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CD24 angl CD24 molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 80 aminokislot a molekulyarna masa 8 097 CD24IdentifikatoriSimvoliCD24 CD24A CD24 moleculeZovnishni ID OMIM 600074 MGI 88323 GeneCards CD24Ontologiya genaMolekulyarna funkciya protein tyrosine kinase activator activity signal transducer activity GO 0001948 GO 0016582 protein binding protein kinase bindingKlitinna komponenta membrana klitinna membrana cell surface anchored component of external side of plasma membrane membrane raft anchored component of membrane vnutrishnoklitinnijBiologichnij proces response to hypoxia regulation of MAPK cascade positive regulation of MAP kinase activity regulation of cytokine mediated signaling pathway positive regulation of cytosolic calcium ion concentration chemokine receptor transport out of membrane raft T cell costimulation regulation of phosphorylation Wnt signaling pathway negative regulation of transforming growth factor beta3 production cell activation immune response regulating cell surface receptor signaling pathway response to estrogen respiratory burst intrinsic apoptotic signaling pathway glomerular parietal epithelial cell differentiation adgeziya klitin glomerular visceral epithelial cell differentiation cholesterol homeostasis regulation of epithelial cell differentiation response to molecule of bacterial origin cell migration B cell receptor transport into membrane raft positive regulation of nephron tubule epithelial cell differentiation positive regulation of activated T cell proliferation positive regulation of protein tyrosine kinase activity cell cell adhesionDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez100133941 12484Ensembl ENSG00000272398 ENSMUSG00000047139UniProt P25063 P24807RefSeq mRNK NM 001291737 NM 001291738 NM 001291739 NM 013230 NM 001359084NM 009846RefSeq bilok NP 001278666 NP 001278667 NP 001278668 NP 037362 NP 001346013NP 033976Lokus UCSC Hr 6 106 97 106 98 MbHr 10 43 45 43 46 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYSA Alanin E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Lokalizovanij u klitinnij membrani membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hough M R Rosten P M Sexton T L Kay R Humphries R K 1994 Mapping of CD24 and homologous sequences to multiple chromosomal loci Genomics 22 154 161 PMID 7959762 DOI 10 1006 geno 1994 1356 Zarn J A Zimmermann S M Pass M K Waibel R Stahel R A 1996 Association of CD24 with the kinase c fgr in a small cell lung cancer cell line and with the kinase lyn in an erythroleukemia cell line Biochem Biophys Res Commun 225 384 391 PMID 8753773 DOI 10 1006 bbrc 1996 1184 Kay R Rosten P M Humphries R K 1991 CD24 a signal transducer modulating B cell activation responses is a very short peptide with a glycosyl phosphatidylinositol membrane anchor J Immunol 147 1412 1416 PMID 1831224 Jackson D Waibel R Weber E Bell J Stahel R A 1992 CD24 a signal transducing molecule expressed on human B cells is a major surface antigen on small cell lung carcinomas Cancer Res 52 5264 5270 PMID 1327504PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1645 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ