Прогібітин-2 (англ. Prohibitin 2) – білок, який кодується геном PHB2, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 299 амінокислот, а молекулярна маса — 33 296.
Прогібітин-2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | PHB2, BAP, BCAP37, Bap37, PNAS-141, REA, p22, hBAP, prohibitin 2, Prohibitin-2 | ||||||||||||||||
Зовнішні ІД | OMIM: 610704 MGI: 102520 HomoloGene: 5263 GeneCards: PHB2 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 6.97 – 6.97 Mb | Хр. 6: 124.69 – 124.69 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAQNLKDLAG | RLPAGPRGMG | TALKLLLGAG | AVAYGVRESV | FTVEGGHRAI | ||||
FFNRIGGVQQ | DTILAEGLHF | RIPWFQYPII | YDIRARPRKI | SSPTGSKDLQ | ||||
MVNISLRVLS | RPNAQELPSM | YQRLGLDYEE | RVLPSIVNEV | LKSVVAKFNA | ||||
SQLITQRAQV | SLLIRRELTE | RAKDFSLILD | DVAITELSFS | REYTAAVEAK | ||||
QVAQQEAQRA | QFLVEKAKQE | QRQKIVQAEG | EAEAAKMLGE | ALSKNPGYIK | ||||
LRKIRAAQNI | SKTIATSQNR | IYLTADNLVL | NLQDESFTRG | SDSLIKGKK |
Цей білок за функціями належить до репресорів, рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Локалізований у цитоплазмі, ядрі, мембрані, мітохондрії, внутрішній мембрані мітохондрії.
Література
- Ansari-Lari M.A., Shen Y., Muzny D.M., Lee W., Gibbs R.A. (1997). Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination. Genome Res. 7: 268—280. PMID 9074930 DOI:10.1101/gr.7.3.268
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:30306 (англ.) . Процитовано 27 лютого 2017.
- UniProt, Q99623 (англ.) . Процитовано 27 лютого 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
Progibitin 2 angl Prohibitin 2 bilok yakij koduyetsya genom PHB2 roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 299 aminokislot a molekulyarna masa 33 296 Progibitin 2IdentifikatoriSimvoliPHB2 BAP BCAP37 Bap37 PNAS 141 REA p22 hBAP prohibitin 2 Prohibitin 2Zovnishni ID OMIM 610704 MGI 102520 HomoloGene 5263 GeneCards PHB2Ontologiya genaMolekulyarna funkciya protein N terminus binding amide binding protein C terminus binding GO 0001948 GO 0016582 protein binding estrogen receptor binding sphingolipid bindingKlitinna komponenta citoplazma membrana nuclear matrix cell surface mitohondrialna zovnishnya membrana mitohondriya ekzosoma klitinne yadro cell periphery mitohondrialna vnutrishnya membrana akson GO 0097483 GO 0097481 postsinaptichne ushilnennya GO 0009327 protein containing complex presynaptic active zone glutamatergic synapse GABA ergic synapseBiologichnij proces GO 0009373 regulation of transcription DNA templated mammary gland branching involved in thelarche protein stabilization regulation of branching involved in mammary gland duct morphogenesis mitochondrion organization negative regulation of mammary gland epithelial cell proliferation positive regulation of DNA binding transcription factor activity positive regulation of exit from mitosis mammary gland alveolus development negative regulation of DNA binding transcription factor activity transcription DNA templated sister chromatid cohesion positive regulation of cell cycle G1 S phase transition positive regulation of ERK1 and ERK2 cascade GO 0045996 negative regulation of transcription DNA templated negative regulation of intracellular estrogen receptor signaling pathway regulation of complement activation mitochondrial calcium ion transmembrane transport response to wounding negative regulation of apoptotic process cellular response to retinoic acid cellular response to hypoxia protein import into nucleus regulation of cytochrome c oxidase activityDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez11331 12034Ensembl ENSG00000215021 ENSMUSG00000004264UniProt Q99623 O35129RefSeq mRNK NM 001144831 NM 001267700NM 007531RefSeq bilok NP 001138303 NP 001254629NP 031557Lokus UCSC Hr 12 6 97 6 97 MbHr 6 124 69 124 69 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAI FFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQ MVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK QVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIK LRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Cej bilok za funkciyami nalezhit do represoriv receptoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi Lokalizovanij u citoplazmi yadri membrani mitohondriyi vnutrishnij membrani mitohondriyi LiteraturaAnsari Lari M A Shen Y Muzny D M Lee W Gibbs R A 1997 Large scale sequencing in human chromosome 12p13 experimental and computational gene structure determination Genome Res 7 268 280 PMID 9074930 DOI 10 1101 gr 7 3 268 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 30306 angl Procitovano 27 lyutogo 2017 UniProt Q99623 angl Procitovano 27 lyutogo 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi