CTNNBIP1 (англ. Catenin beta interacting protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 81 амінокислот, а молекулярна маса — 9 170.
CTNNBIP1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CTNNBIP1, ICAT, catenin beta interacting protein 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 607758 MGI: 1915756 HomoloGene: 10641 GeneCards: CTNNBIP1 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 9.85 – 9.91 Mb | Хр. 4: 149.6 – 149.65 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MNREGAPGKS | PEEMYIQQKV | RVLLMLRKMG | SNLTASEEEF | LRTYAGVVNS | ||||
QLSQLPPHSI | DQGAEDVVMA | FSRSETEDRR | Q |
Задіяний у такому біологічному процесі як сигнальний шлях Wnt. Локалізований у цитоплазмі, ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Graham T.A., Clements W.K., Kimelman D., Xu W. (2002). The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT. Mol. Cell. 10: 563—571. PMID 12408824 DOI:10.1016/S1097-2765(02)00637-8
- Daniels D.L., Weis W.I. (2002). ICAT inhibits beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules. Mol. Cell. 10: 573—584. PMID 12408825 DOI:10.1016/S1097-2765(02)00631-7
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 20 липня 2017. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CTNNBIP1 angl Catenin beta interacting protein 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 81 aminokislot a molekulyarna masa 9 170 CTNNBIP1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1M1E 1T08IdentifikatoriSimvoliCTNNBIP1 ICAT catenin beta interacting protein 1Zovnishni ID OMIM 607758 MGI 1915756 HomoloGene 10641 GeneCards CTNNBIP1Ontologiya genaMolekulyarna funkciya beta catenin binding GO 0001948 GO 0016582 protein binding armadillo repeat domain bindingKlitinna komponenta citoplazma gialoplazma nukleoplazma klitinne yadro beta catenin destruction complexBiologichnij proces negative regulation of smooth muscle cell proliferation GO 0106160 negative regulation of protein containing complex assembly negative regulation of DNA binding negative regulation of Wnt signaling pathway regulation of vascular permeability involved in acute inflammatory response GO 1901227 negative regulation of transcription by RNA polymerase II Wnt signaling pathway negative regulation of protein binding negative regulation of DNA binding transcription factor activity branching involved in ureteric bud morphogenesis positive regulation of osteoblast differentiation positive regulation of monocyte differentiation negative regulation of transcription initiation from RNA polymerase II promoter negative regulation of mesenchymal cell proliferation anterior posterior pattern specificationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez56998 67087Ensembl ENSG00000178585 ENSMUSG00000028988UniProt Q9NSA3 Q9JJN6RefSeq mRNK NM 020248 NM 001012329NM 001141930 NM 023465RefSeq bilok NP 001012329 NP 064633NP 001135402 NP 075954Lokus UCSC Hr 1 9 85 9 91 MbHr 4 149 6 149 65 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNS QLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takomu biologichnomu procesi yak signalnij shlyah Wnt Lokalizovanij u citoplazmi yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Graham T A Clements W K Kimelman D Xu W 2002 The crystal structure of the beta catenin ICAT complex reveals the inhibitory mechanism of ICAT Mol Cell 10 563 571 PMID 12408824 DOI 10 1016 S1097 2765 02 00637 8 Daniels D L Weis W I 2002 ICAT inhibits beta catenin binding to Tcf Lef family transcription factors and the general coactivator p300 using independent structural modules Mol Cell 10 573 584 PMID 12408825 DOI 10 1016 S1097 2765 02 00631 7PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 20 lipnya 2017 Procitovano 25 serpnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi