Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CRYAB англ Crystallin alpha B білок який кодується однойменним геном розташованим у людей на короткому плечі 11 ї хромос

CRYAB

CRYAB

CRYAB (англ. Crystallin alpha B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 175 амінокислот, а молекулярна маса — 20 159.

CRYAB
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CRYAB, CMD1II, CRYA2, CTPP2, CTRCT16, HEL-S-101, HSPB5, MFM2, crystallin alpha B
Зовнішні ІД OMIM: 123590 MGI: 88516 HomoloGene: 68209 GeneCards: CRYAB
Пов'язані генетичні захворювання
myofibrillar myopathy 2, dilated cardiomyopathy 1II, early-onset posterior polar cataract
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1410
12955
Ensembl
ENSG00000109846
ENSMUSG00000032060
UniProt
P02511
P23927
RefSeq (мРНК)
NM_001289782
NM_001289784
NM_001289785
NM_009964
RefSeq (білок)
NP_001276711
NP_001276713
NP_001276714
NP_034094
Локус (UCSC) Хр. 11: 111.91 – 111.92 Mb Хр. 9: 50.66 – 50.67 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR
PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV
HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
QVSGPERTIPITREEKPAVTAAPKK

Кодований геном білок за функціями належить до шаперонів, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література

  • Kramps J.A., de Man B.M., de Jong W.W. (1977). The primary structure of the B2 chain of human alpha-crystallin. FEBS Lett. 74: 82—84. PMID 838078 DOI:10.1016/0014-5793(77)80757-6
  • Dubin R.A., Ally A.H., Chung S., Piatigorsky J. (1990). Human alpha B-crystallin gene and preferential promoter function in lens. Genomics. 7: 594—601. PMID 2387586 DOI:10.1016/0888-7543(90)90204-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Iwaki T., Kume-Iwaki A., Liem R.K.H., Goldman J.E. (1989). Alpha B-crystallin is expressed in non-lenticular tissues and accumulates in Alexander's disease brain. Cell. 57: 71—78. PMID 2539261 DOI:10.1016/0092-8674(89)90173-6
  • Fujii N., Ishibashi Y., Satoh K., Fujino M., Harada K. (1994). Simultaneous racemization and isomerization at specific aspartic acid residues in alpha B-crystallin from the aged human lens. Biochim. Biophys. Acta. 1204: 157—163. PMID 8142454 DOI:10.1016/0167-4838(94)90003-5
  • Hanson S.R.A., Hasan A., Smith D.L., Smith J.B. (2000). The major in vivo modifications of the human water-insoluble lens crystallins are disulfide bonds, deamidation, methionine oxidation and backbone cleavage. Exp. Eye Res. 71: 195—207. PMID 10930324 DOI:10.1006/exer.2000.0868

Примітки

  1. Захворювання, генетично пов'язані з CRYAB переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:2389 (англ.) . Процитовано 8 вересня 2017.
  5. (англ.) . Архів оригіналу за 24 вересня 2017. Процитовано 8 вересня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CRYAB angl Crystallin alpha B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 175 aminokislot a molekulyarna masa 20 159 CRYABNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2KLR 2N0K 2WJ7 2Y1Y 2Y1Z 2Y22 2YGD 3L1G 3SGM 3SGN 3SGO 3SGP 3SGR 3SGS 4M5S 4M5T 3J07IdentifikatoriSimvoliCRYAB CMD1II CRYA2 CTPP2 CTRCT16 HEL S 101 HSPB5 MFM2 crystallin alpha BZovnishni ID OMIM 123590 MGI 88516 HomoloGene 68209 GeneCards CRYABPov yazani genetichni zahvoryuvannyamyofibrillar myopathy 2 dilated cardiomyopathy 1II early onset posterior polar cataract Ontologiya genaMolekulyarna funkciya protein homodimerization activity microtubule binding unfolded protein binding zv yazuvannya z ionom metalu cytoskeletal protein binding GO 0001948 GO 0016582 protein binding structural constituent of eye lens identical protein binding amyloid beta binding GO 0032403 protein containing complex bindingKlitinna komponenta citoplazma kompleks Goldzhi I band microtubule cytoskeleton nukleoplazma cell surface actin filament bundle ekzosoma klitinne yadro cardiac myofibril perikarion dendritic spine synaptic membrane sinaps M band GO 0097483 GO 0097481 postsinaptichne ushilnennya akson mitohondriya gialoplazma klitinna membrana Z disc contractile fiber GO 0009327 protein containing complexBiologichnij proces negative regulation of intracellular transport response to estradiol m yazove skorochennya regulation of cell death GO 0010260 starinnya lyudini negative regulation of apoptotic process microtubule polymerization or depolymerization zgortannya bilkiv stress activated MAPK cascade negative regulation of cell growth cellular response to gamma radiation regulation of cellular response to heat negative regulation of reactive oxygen species metabolic process protein homooligomerization response to hydrogen peroxide response to hypoxia lens development in camera type eye tubulin complex assembly muscle organ development multicellular organism aging negative regulation of gene expression negative regulation of protein homooligomerization camera type eye development negative regulation of cysteine type endopeptidase activity involved in apoptotic process protein stabilization apoptotic process involved in morphogenesis negative regulation of amyloid fibril formation GO 0045996 negative regulation of transcription DNA templatedDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1410 12955Ensembl ENSG00000109846 ENSMUSG00000032060UniProt P02511 P23927RefSeq mRNK NM 001289807 NM 001289808 NM 001885 NM 001330379 NM 001368245NM 001368246NM 001289782 NM 001289784 NM 001289785 NM 009964RefSeq bilok NP 001276736 NP 001276737 NP 001317308 NP 001876 NP 001355174NP 001355175NP 001276711 NP 001276713 NP 001276714 NP 034094Lokus UCSC Hr 11 111 91 111 92 MbHr 9 50 66 50 67 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK QVSGPERTIPITREEKPAVTAAPKK A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do shaperoniv fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak acetilyuvannya Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Lokalizovanij u citoplazmi yadri LiteraturaKramps J A de Man B M de Jong W W 1977 The primary structure of the B2 chain of human alpha crystallin FEBS Lett 74 82 84 PMID 838078 DOI 10 1016 0014 5793 77 80757 6 Dubin R A Ally A H Chung S Piatigorsky J 1990 Human alpha B crystallin gene and preferential promoter function in lens Genomics 7 594 601 PMID 2387586 DOI 10 1016 0888 7543 90 90204 8 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Iwaki T Kume Iwaki A Liem R K H Goldman J E 1989 Alpha B crystallin is expressed in non lenticular tissues and accumulates in Alexander s disease brain Cell 57 71 78 PMID 2539261 DOI 10 1016 0092 8674 89 90173 6 Fujii N Ishibashi Y Satoh K Fujino M Harada K 1994 Simultaneous racemization and isomerization at specific aspartic acid residues in alpha B crystallin from the aged human lens Biochim Biophys Acta 1204 157 163 PMID 8142454 DOI 10 1016 0167 4838 94 90003 5 Hanson S R A Hasan A Smith D L Smith J B 2000 The major in vivo modifications of the human water insoluble lens crystallins are disulfide bonds deamidation methionine oxidation and backbone cleavage Exp Eye Res 71 195 207 PMID 10930324 DOI 10 1006 exer 2000 0868PrimitkiZahvoryuvannya genetichno pov yazani z CRYAB pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2389 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 24 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ