TFPI (англ. Tissue factor pathway inhibitor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 304 амінокислот, а молекулярна маса — 35 015.
TFPI | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | TFPI, EPI, LACI, TFI, TFPI1, tissue factor pathway inhibitor | ||||||||||||||||
Зовнішні ІД | OMIM: 152310 MGI: 1095418 HomoloGene: 4579 GeneCards: TFPI | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 187.46 – 187.57 Mb | Хр. 2: 84.26 – 84.31 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MIYTMKKVHA | LWASVCLLLN | LAPAPLNADS | EEDEEHTIIT | DTELPPLKLM | ||||
HSFCAFKADD | GPCKAIMKRF | FFNIFTRQCE | EFIYGGCEGN | QNRFESLEEC | ||||
KKMCTRDNAN | RIIKTTLQQE | KPDFCFLEED | PGICRGYITR | YFYNNQTKQC | ||||
ERFKYGGCLG | NMNNFETLEE | CKNICEDGPN | GFQVDNYGTQ | LNAVNNSLTP | ||||
QSTKVPSLFE | FHGPSWCLTP | ADRGLCRANE | NRFYYNSVIG | KCRPFKYSGC | ||||
GGNENNFTSK | QECLRACKKG | FIQRISKGGL | IKTKRKRKKQ | RVKIAYEEIF | ||||
VKNM |
Кодований геном білок за функціями належить до інгібіторів протеаз, . Задіяний у таких біологічних процесах як зсідання крові, гемостаз, поліморфізм, альтернативний сплайсинг. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах. Також секретований назовні.
Література
- van der Logt C.P.E., Reitsma P.H., Bertina R.M. (1991). Intron-exon organization of the human gene coding for the lipoprotein-associated coagulation inhibitor: the factor Xa dependent inhibitor of the extrinsic pathway of coagulation. Biochemistry. 30: 1571—1577. PMID 1993173 DOI:10.1021/bi00220a018
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Broze G.J. Jr., Girard T.J., Novotny W.F. (1990). Regulation of coagulation by a multivalent Kunitz-type inhibitor. Biochemistry. 29: 7539—7546. PMID 2271516 DOI:10.1021/bi00485a001
- Girard T.J., Tuley E., Broze G.J. Jr. (2012). TFPIbeta is the GPI-anchored TFPI isoform on human endothelial cells and placental microsomes. Blood. 119: 1256—1262. PMID 22144186 DOI:10.1182/blood-2011-10-388512
- Mine S., Yamazaki T., Miyata T., Hara S., Kato H. (2002). Structural mechanism for heparin-binding of the third Kunitz domain of human tissue factor pathway inhibitor. Biochemistry. 41: 78—85. PMID 11772005 DOI:10.1021/bi011299g
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:11760 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 26 вересня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
TFPI angl Tissue factor pathway inhibitor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 304 aminokislot a molekulyarna masa 35 015 TFPINayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4DTG 1ADZ 1IRH 1TFX 4BQDIdentifikatoriSimvoliTFPI EPI LACI TFI TFPI1 tissue factor pathway inhibitorZovnishni ID OMIM 152310 MGI 1095418 HomoloGene 4579 GeneCards TFPIOntologiya genaMolekulyarna funkciya peptidase inhibitor activity endopeptidase inhibitor activity serine type endopeptidase inhibitor activityKlitinna komponenta organelle membrane extracellular region cell surface anchored component of membrane klitinna membrana endoplazmatichnij retikulum membrana vnutrishnoklitinna membranna organela mizhklitinnij prostir caveolaBiologichnij proces gemostaz blood coagulation extrinsic pathway negative regulation of peptidase activity zsidannya krovi response to lipopolysaccharide response to estradiol cellular response to lipopolysaccharide negative regulation of endopeptidase activity cellular response to interleukin 1 negative regulation of blood coagulation cellular response to steroid hormone stimulusDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7035 21788Ensembl ENSG00000003436 ENSMUSG00000027082UniProt P10646 O54819RefSeq mRNK NM 001032281 NM 006287 NM 001318941 NM 001329239 NM 001329240NM 001329241NM 001177319 NM 001177320 NM 011576 NM 001355271 NM 001355273RefSeq bilok NP 001027452 NP 001305870 NP 001316168 NP 001316169 NP 001316170NP 006278NP 001170790 NP 001170791 NP 035706 NP 001342200 NP 001342202Lokus UCSC Hr 2 187 46 187 57 MbHr 2 84 26 84 31 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLM HSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEEC KKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQC ERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTP QSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGC GGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF VKNM A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do ingibitoriv proteaz Zadiyanij u takih biologichnih procesah yak zsidannya krovi gemostaz polimorfizm alternativnij splajsing Lokalizovanij u membrani endoplazmatichnomu retikulumi mikrosomah Takozh sekretovanij nazovni Literaturavan der Logt C P E Reitsma P H Bertina R M 1991 Intron exon organization of the human gene coding for the lipoprotein associated coagulation inhibitor the factor Xa dependent inhibitor of the extrinsic pathway of coagulation Biochemistry 30 1571 1577 PMID 1993173 DOI 10 1021 bi00220a018 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Broze G J Jr Girard T J Novotny W F 1990 Regulation of coagulation by a multivalent Kunitz type inhibitor Biochemistry 29 7539 7546 PMID 2271516 DOI 10 1021 bi00485a001 Girard T J Tuley E Broze G J Jr 2012 TFPIbeta is the GPI anchored TFPI isoform on human endothelial cells and placental microsomes Blood 119 1256 1262 PMID 22144186 DOI 10 1182 blood 2011 10 388512 Mine S Yamazaki T Miyata T Hara S Kato H 2002 Structural mechanism for heparin binding of the third Kunitz domain of human tissue factor pathway inhibitor Biochemistry 41 78 85 PMID 11772005 DOI 10 1021 bi011299gPrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11760 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 26 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij