BECN1 (англ. Beclin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 450 амінокислот, а молекулярна маса — 51 896.
BECN1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BECN1, ATG6, VPS30, beclin1, beclin 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 604378 MGI: 1891828 HomoloGene: 2794 GeneCards: BECN1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 17: 42.81 – 42.83 Mb | Хр. 11: 101.18 – 101.19 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEGSKTSNNS | TMQVSFVCQR | CSQPLKLDTS | FKILDRVTIQ | ELTAPLLTTA | ||||
QAKPGETQEE | ETNSGEEPFI | ETPRQDGVSR | RFIPPARMMS | TESANSFTLI | ||||
GEASDGGTME | NLSRRLKVTG | DLFDIMSGQT | DVDHPLCEEC | TDTLLDQLDT | ||||
QLNVTENECQ | NYKRCLEILE | QMNEDDSEQL | QMELKELALE | EERLIQELED | ||||
VEKNRKIVAE | NLEKVQAEAE | RLDQEEAQYQ | REYSEFKRQQ | LELDDELKSV | ||||
ENQMRYAQTQ | LDKLKKTNVF | NATFHIWHSG | QFGTINNFRL | GRLPSVPVEW | ||||
NEINAAWGQT | VLLLHALANK | MGLKFQRYRL | VPYGNHSYLE | SLTDKSKELP | ||||
LYCSGGLRFF | WDNKFDHAMV | AFLDCVQQFK | EEVEKGETRF | CLPYRMDVEK | ||||
GKIEDTGGSG | GSYSIKTQFN | SEEQWTKALK | FMLTNLKWGL | AWVSSQFYNK | ||||
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, взаємодія хазяїн-вірус, клітинний цикл, поділ клітини, ендоцитоз, автофагія, противірусний захист, ацетилювання. Локалізований у цитоплазмі, ядрі, мембрані, мітохондрії, ендоплазматичному ретикулумі, цитоплазматичних везикулах, апараті гольджі, ендосомах.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Itakura E., Kishi C., Inoue K., Mizushima N. (2008). Beclin 1 forms two distinct phosphatidylinositol 3-kinase complexes with mammalian Atg14 and UVRAG. Mol. Biol. Cell. 19: 5360—5372. PMID 18843052 DOI:10.1091/mbc.E08-01-0080
- Thoresen S.B., Pedersen N.M., Liestol K., Stenmark H. (2010). A phosphatidylinositol 3-kinase class III sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates cytokinesis and degradative endocytic traffic. Exp. Cell Res. 316: 3368—3378. PMID 20643123 DOI:10.1016/j.yexcr.2010.07.008
- Luo S., Rubinsztein D.C. (2010). Apoptosis blocks Beclin 1-dependent autophagosome synthesis: an effect rescued by Bcl-xL. Cell Death Differ. 17: 268—277. PMID 19713971 DOI:10.1038/cdd.2009.121
- Platta H.W., Abrahamsen H., Thoresen S.B., Stenmark H. (2012). Nedd4-dependent lysine-11-linked polyubiquitination of the tumour suppressor Beclin 1. Biochem. J. 441: 399—406. PMID 21936852 DOI:10.1042/BJ20111424
- Siddiqui M.A., Mukherjee S., Manivannan P., Malathi K. (2015). RNase L cleavage products promote switch from autophagy to apoptosis by caspase-mediated cleavage of beclin-1. Int. J. Mol. Sci. 16: 17611—17636. PMID 26263979 DOI:10.3390/ijms160817611
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 7 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BECN1 angl Beclin 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 450 aminokislot a molekulyarna masa 51 896 BECN1Nayavni strukturiPDBPoshuk ortologiv K7ER46 PDBe K7ER46 RCSB Spisok kodiv PDB2P1L 2PON 3DVU 4DDP 4MI8IdentifikatoriSimvoliBECN1 ATG6 VPS30 beclin1 beclin 1Zovnishni ID OMIM 604378 MGI 1891828 HomoloGene 2794 GeneCards BECN1Ontologiya genaMolekulyarna funkciya phosphatidylinositol 3 kinase binding GO 0001948 GO 0016582 protein binding GTPase binding ubiquitin protein ligase binding protein kinase binding protein homodimerization activityKlitinna komponenta endosome membrane citoplazma mitohondrialna membrana trans Golgi network kompleks Goldzhi gialoplazma klitinne yadro autophagosome phagophore assembly site membrana dendrit nejrobiologiya endoplazmatichnij retikulum phosphatidylinositol 3 kinase complex class III endoplasmic reticulum membrane phosphatidylinositol 3 kinase complex class III type II GO 0016023 cytoplasmic vesicle endosoma extrinsic component of membrane phosphatidylinositol 3 kinase complex class III type I phagocytic vesicle mitohondriya GO 0009327 protein containing complexBiologichnij proces negative regulation of cell population proliferation response to hypoxia cellular response to aluminum ion response to vitamin E lysosome organization klitinnij cikl positive regulation of phosphatidylinositol 3 kinase signaling cellular response to glucose starvation cellular defense response Citokinez cellular response to epidermal growth factor stimulus podil klitini receptor catabolic process autophagy of nucleus cellular response to nitrogen starvation GO 0022415 viral process late endosome to vacuole transport GO 0097285 apoptoz cytoplasm to vacuole transport by the Cvt pathway endocitoz engulfment of apoptotic cell positive regulation of attachment of mitotic spindle microtubules to kinetochore amyloid beta metabolic process neuron development defense response to virus response to other organism mitotic metaphase plate congression GO 0048552 regulation of catalytic activity negative regulation of reactive oxygen species metabolic process regulation of cytokinesis negative regulation of apoptotic process negative regulation of cell death autophagosome assembly macroautophagy GO 0010260 starinnya lyudini response to iron II ion response to lead ion protein deubiquitination response to nutrient levels cellular response to amino acid starvation cellular response to hydrogen peroxide cellular response to copper ion negative regulation of lysosome organization positive regulation of autophagosome assembly autophagy of mitochondrion mitophagy avtofagiya positive regulation of autophagy response to mitochondrial depolarisation early endosome to late endosome transport negative regulation of autophagy positive regulation of cardiac muscle hypertrophy negative regulation of autophagosome assembly positive regulation of intrinsic apoptotic signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez8678 56208Ensembl ENSG00000126581 ENSMUSG00000035086UniProt Q14457 O88597RefSeq mRNK NM 001313998 NM 001313999 NM 001314000 NM 003766NM 019584 NM 001359819 NM 001359820 NM 001359821RefSeq bilok NP 001300927 NP 001300928 NP 001300929 NP 003757NP 062530 NP 001346748 NP 001346749 NP 001346750Lokus UCSC Hr 17 42 81 42 83 MbHr 11 101 18 101 19 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTA QAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLI GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELED VEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSV ENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEK GKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz vzayemodiya hazyayin virus klitinnij cikl podil klitini endocitoz avtofagiya protivirusnij zahist acetilyuvannya Lokalizovanij u citoplazmi yadri membrani mitohondriyi endoplazmatichnomu retikulumi citoplazmatichnih vezikulah aparati goldzhi endosomah LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Itakura E Kishi C Inoue K Mizushima N 2008 Beclin 1 forms two distinct phosphatidylinositol 3 kinase complexes with mammalian Atg14 and UVRAG Mol Biol Cell 19 5360 5372 PMID 18843052 DOI 10 1091 mbc E08 01 0080 Thoresen S B Pedersen N M Liestol K Stenmark H 2010 A phosphatidylinositol 3 kinase class III sub complex containing VPS15 VPS34 Beclin 1 UVRAG and BIF 1 regulates cytokinesis and degradative endocytic traffic Exp Cell Res 316 3368 3378 PMID 20643123 DOI 10 1016 j yexcr 2010 07 008 Luo S Rubinsztein D C 2010 Apoptosis blocks Beclin 1 dependent autophagosome synthesis an effect rescued by Bcl xL Cell Death Differ 17 268 277 PMID 19713971 DOI 10 1038 cdd 2009 121 Platta H W Abrahamsen H Thoresen S B Stenmark H 2012 Nedd4 dependent lysine 11 linked polyubiquitination of the tumour suppressor Beclin 1 Biochem J 441 399 406 PMID 21936852 DOI 10 1042 BJ20111424 Siddiqui M A Mukherjee S Manivannan P Malathi K 2015 RNase L cleavage products promote switch from autophagy to apoptosis by caspase mediated cleavage of beclin 1 Int J Mol Sci 16 17611 17636 PMID 26263979 DOI 10 3390 ijms160817611PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 10 veresnya 2015 Procitovano 12 veresnya 2017 angl Arhiv originalu za 7 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi