Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
S100A10 (англ. S100 calcium binding protein A10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 97 амінокислот, а молекулярна маса — 11 203.
| S100A10 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | S100A10, 42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10, S100 calcium binding protein A10 | ||||||||||||||||
| Зовнішні ІД | OMIM: 114085 MGI: 1339468 HomoloGene: 2228 GeneCards: S100A10 | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 1: 151.98 – 151.99 Mb | Хр. 3: 93.46 – 93.47 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MPSQMEHAME | TMMFTFHKFA | GDKGYLTKED | LRVLMEKEFP | GFLENQKDPL | ||||
| AVDKIMKDLD | QCRDGKVGFQ | SFFSLIAGLT | IACNDYFVVH | MKQKGKK |
Задіяний у такому біологічному процесі як ацетиляція.
Література
- Kube E., Weber K., Gerke V. (1991). Primary structure of human, chicken, and Xenopus laevis p11, a cellular ligand of the Src-kinase substrate, annexin II. Gene. 102: 255—259. PMID 1831433 DOI:10.1016/0378-1119(91)90086-Q
- Harder T., Kube E., Gerke V. (1992). Cloning and characterization of the human gene encoding p11: structural similarity to other members of the S-100 gene family. Gene. 113: 269—274. PMID 1533380 DOI:10.1016/0378-1119(92)90406-F
- Dooley T.P., Weiland K.L., Simon M. (1992). cDNA sequence of human p11 calpactin I light chain. Genomics. 13: 866—868. PMID 1386341 DOI:10.1016/0888-7543(92)90171-N
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10487 (англ.) . Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 24 лютого 2018. Процитовано 25 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
S100A10 angl S100 calcium binding protein A10 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 97 aminokislot a molekulyarna masa 11 203 S100A10Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1A4P 1BT6 4DRW 4FTG 4HRE 4HRG 4HRHIdentifikatoriSimvoliS100A10 42C ANX2L ANX2LG CAL1L CLP11 Ca 1 GP11 P11 p10 S100 calcium binding protein A10Zovnishni ID OMIM 114085 MGI 1339468 HomoloGene 2228 GeneCards S100A10Ontologiya genaMolekulyarna funkciya calcium ion binding GO 0001948 GO 0016582 protein binding protein homodimerization activity transmembrane transporter binding lipid bindingKlitinna komponenta membrane raft extrinsic component of plasma membrane ekzosoma endoplazmatichnij retikulum extracellular region collagen containing extracellular matrixBiologichnij proces positive regulation of focal adhesion assembly GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity positive regulation of substrate adhesion dependent cell spreading positive regulation of binding protein heterotetramerization membrane raft assembly vesicle budding from membrane positive regulation of stress fiber assembly protein localization to plasma membraneDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6281 20194Ensembl ENSG00000197747 ENSMUSG00000041959UniProt P60903 P08207RefSeq mRNK NM 002966NM 009112RefSeq bilok NP 002957NP 033138Lokus UCSC Hr 1 151 98 151 99 MbHr 3 93 46 93 47 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takomu biologichnomu procesi yak acetilyaciya LiteraturaKube E Weber K Gerke V 1991 Primary structure of human chicken and Xenopus laevis p11 a cellular ligand of the Src kinase substrate annexin II Gene 102 255 259 PMID 1831433 DOI 10 1016 0378 1119 91 90086 Q Harder T Kube E Gerke V 1992 Cloning and characterization of the human gene encoding p11 structural similarity to other members of the S 100 gene family Gene 113 269 274 PMID 1533380 DOI 10 1016 0378 1119 92 90406 F Dooley T P Weiland K L Simon M 1992 cDNA sequence of human p11 calpactin I light chain Genomics 13 866 868 PMID 1386341 DOI 10 1016 0888 7543 92 90171 N The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10487 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 24 lyutogo 2018 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi