POLR2F (англ. RNA polymerase II subunit F) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 127 амінокислот, а молекулярна маса — 14 478.
POLR2F | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | POLR2F, HRBP14.4, POLRF, RPABC14.4, RPABC2, RPB14.4, RPB6, RPC15, polymerase (RNA) II subunit F, RNA polymerase II subunit F, RNA polymerase II, I and III subunit F | ||||||||||||||||
Зовнішні ІД | OMIM: 604414 MGI: 1349393 HomoloGene: 7178 GeneCards: POLR2F | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 22: 37.95 – 38.04 Mb | Хр. 15: 79.03 – 79.04 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSDNEDNFDG | DDFDDVEEDE | GLDDLENAEE | EGQENVEILP | SGERPQANQK | ||||
RITTPYMTKY | ERARVLGTRA | LQIAMCAPVM | VELEGETDPL | LIAMKELKAR | ||||
KIPIIIRRYL | PDGSYEDWGV | DELIITD |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, ацетилювання. Локалізований у ядрі.
Література
- Acker J., Wintzerith M., Vigneron M., Kedinger C. (1994). A 14.4 KDa acidic subunit of human RNA polymerase II with a putative leucine-zipper. DNA Seq. 4: 329—331. PMID 7803819 DOI:10.3109/10425179409020860
- Pusch C., Wang Z., Roe B., Blin N. (1996). Genomic structure of the RNA polymerase II small subunit (hRPB14.4) locus (POLRF) and mapping to 22q13.1 by sequence identity. Genomics. 34: 440—442. PMID 8786150 DOI:10.1006/geno.1996.0312
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kershnar E., Wu S.-Y., Chiang C.-M. (1998). Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J. Biol. Chem. 273: 34444—34453. PMID 9852112 DOI:10.1074/jbc.273.51.34444
- del Rio-Portilla F., Gaskell A., Gilbert D., Ladias J.A., Wagner G. (1999). Solution structure of the hRPABC14.4 subunit of human RNA polymerases. Nat. Struct. Biol. 6: 1039—1042. PMID 10542096 DOI:10.1038/14923
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 19 липня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 12 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
POLR2F angl RNA polymerase II subunit F bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 127 aminokislot a molekulyarna masa 14 478 POLR2FNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1QKL 5FLM 5IY9 5IYA 5IYC 5IYB 5IY7 5IY8 5IYD 5IY6IdentifikatoriSimvoliPOLR2F HRBP14 4 POLRF RPABC14 4 RPABC2 RPB14 4 RPB6 RPC15 polymerase RNA II subunit F RNA polymerase II subunit F RNA polymerase II I and III subunit FZovnishni ID OMIM 604414 MGI 1349393 HomoloGene 7178 GeneCards POLR2FOntologiya genaMolekulyarna funkciya DNA binding RNA polymerase II activity RNA polymerase III activity DNA directed 5 3 RNA polymerase activity RNA polymerase I activityKlitinna komponenta gialoplazma nukleoplazma RNA polymerase I complex RNA polymerase III complex RNK polimeraza II klitinne yadro fibrillar centerBiologichnij proces termination of RNA polymerase I transcription mRNA splicing via spliceosome epigenetic maintenance of chromatin in transcription competent conformation transcription initiation from RNA polymerase I promoter transcription elongation from RNA polymerase II promoter 7 methylguanosine mRNA capping transcription by RNA polymerase II transcription coupled nucleotide excision repair transcription initiation from RNA polymerase II promoter snRNA transcription by RNA polymerase II fibroblast growth factor receptor signaling pathway transcription by RNA polymerase III RNA metabolic process GO 1905616 regulation of gene silencing by miRNA transcription DNA templated GO 0001183 transcription elongation from RNA polymerase I promoter positive regulation of type I interferon production somatic stem cell population maintenance positive regulation of viral transcriptionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5435 69833Ensembl ENSG00000100142 ENSMUSG00000033020UniProt P61218 P61219RefSeq mRNK NM 001301129 NM 001301130 NM 001301131 NM 021974 NM 001363825NM 027231RefSeq bilok NP 001288058 NP 001288059 NP 001288060 NP 068809 NP 001350754NP 081507Lokus UCSC Hr 22 37 95 38 04 MbHr 15 79 03 79 04 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQK RITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKAR KIPIIIRRYLPDGSYEDWGVDELIITD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya acetilyuvannya Lokalizovanij u yadri LiteraturaAcker J Wintzerith M Vigneron M Kedinger C 1994 A 14 4 KDa acidic subunit of human RNA polymerase II with a putative leucine zipper DNA Seq 4 329 331 PMID 7803819 DOI 10 3109 10425179409020860 Pusch C Wang Z Roe B Blin N 1996 Genomic structure of the RNA polymerase II small subunit hRPB14 4 locus POLRF and mapping to 22q13 1 by sequence identity Genomics 34 440 442 PMID 8786150 DOI 10 1006 geno 1996 0312 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kershnar E Wu S Y Chiang C M 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope tagged subunits of the multiprotein complexes J Biol Chem 273 34444 34453 PMID 9852112 DOI 10 1074 jbc 273 51 34444 del Rio Portilla F Gaskell A Gilbert D Ladias J A Wagner G 1999 Solution structure of the hRPABC14 4 subunit of human RNA polymerases Nat Struct Biol 6 1039 1042 PMID 10542096 DOI 10 1038 14923PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 19 lipnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 12 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 22 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi