FUT3 (англ. Fucosyltransferase 3 (Lewis blood group)) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 361 амінокислот, а молекулярна маса — 42 117.
FUT3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | FUT3, CD174, FT3B, FucT-III, LE, Les, Fucosyltransferase 3, fucosyltransferase 3 (Lewis blood group) | ||||||||||||||||
Зовнішні ІД | HomoloGene: 128031 GeneCards: FUT3 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 5.84 – 5.85 Mb | н/д | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDPLGAAKPQ | WPWRRCLAAL | LFQLLVAVCF | FSYLRVSRDD | ATGSPRAPSG | ||||
SSRQDTTPTR | PTLLILLWTW | PFHIPVALSR | CSEMVPGTAD | CHITADRKVY | ||||
PQADTVIVHH | WDIMSNPKSR | LPPSPRPQGQ | RWIWFNLEPP | PNCQHLEALD | ||||
RYFNLTMSYR | SDSDIFTPYG | WLEPWSGQPA | HPPLNLSAKT | ELVAWAVSNW | ||||
KPDSARVRYY | QSLQAHLKVD | VYGRSHKPLP | KGTMMETLSR | YKFYLAFENS | ||||
LHPDYITEKL | WRNALEAWAV | PVVLGPSRSN | YERFLPPDAF | IHVDDFQSPK | ||||
DLARYLQELD | KDHARYLSYF | RWRETLRPRS | FSWALDFCKA | CWKLQQESRY | ||||
QTVRSIAAWF | T |
Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Локалізований у мембрані, апараті гольджі.
Література
- Kukowska-Latallo J.F., Larsen R.D., Nair R.P., Lowe J.B. (1990). A cloned human cDNA determines expression of a mouse stage-specific embryonic antigen and the Lewis blood group alpha(1,3/1,4)fucosyltransferase. Genes Dev. 4: 1288—1303. PMID 1977660 DOI:10.1101/gad.4.8.1288
- Cameron H.S., Szczepaniak D., Weston B.W. (1995). Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms. J. Biol. Chem. 270: 20112—20122. PMID 7650030 DOI:10.1074/jbc.270.34.20112
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Elmgren A., Rydberg L., Larson G. (1993). Genotypic heterogeneity among Lewis negative individuals. Biochem. Biophys. Res. Commun. 196: 515—520. PMID 8240322 DOI:10.1006/bbrc.1993.2280
- Elmgren A., Boerjeson C., Svensson L., Rydberg L., Larson G. (1996). DNA sequencing and screening for point mutations in the human Lewis 'FUT3' gene enables molecular genotyping of the human Lewis blood group system. Vox Sang. 70: 97—103. PMID 8801770 DOI:10.1111/j.1423-0410.1996.tb01300.x
- Koda Y., Kimura H., Mekada E. (1993). Analysis of Lewis fucosyltransferase genes from the human gastric mucosa of Lewis-positive and -negative individuals. Blood. 82: 2915—2919. PMID 8219240
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4014 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 13 березня 2018. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FUT3 angl Fucosyltransferase 3 Lewis blood group bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 361 aminokislot a molekulyarna masa 42 117 FUT3IdentifikatoriSimvoliFUT3 CD174 FT3B FucT III LE Les Fucosyltransferase 3 fucosyltransferase 3 Lewis blood group Zovnishni ID HomoloGene 128031 GeneCards FUT3Ontologiya genaMolekulyarna funkciya transferase activity alpha 1 gt 3 fucosyltransferase activity fucosyltransferase activity glycosyltransferase activity 3 galactosyl N acetylglucosaminide 4 alpha L fucosyltransferase activityKlitinna komponenta integral component of membrane Golgi cisterna membrane kompleks Goldzhi ekzosoma membrana Golgi membraneBiologichnij proces cell cell recognition oligosaccharide biosynthetic process GO 0033578 GO 0033577 GO 0033575 GO 0033576 protein glycosylation macromolecule glycosylation fucosylation ceramide metabolic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2525 173958Ensembl ENSG00000171124 WBGene00006402UniProt P21217 G5EFP5RefSeq mRNK NM 000149 NM 001097639 NM 001097640 NM 001097641 NM 001374740NM 062705RefSeq bilok NP 000140 NP 001091108 NP 001091109 NP 001091110 NP 001361669NP 001369673 NP 001369674 NP 001369675 NP 001369676 NP 001369677 NP 001369678 NP 001369679NP 495106Lokus UCSC Hr 19 5 84 5 85 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSG SSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVY PQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALD RYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNW KPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENS LHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPK DLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRY QTVRSIAAWFT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz glikoziltransferaz Lokalizovanij u membrani aparati goldzhi LiteraturaKukowska Latallo J F Larsen R D Nair R P Lowe J B 1990 A cloned human cDNA determines expression of a mouse stage specific embryonic antigen and the Lewis blood group alpha 1 3 1 4 fucosyltransferase Genes Dev 4 1288 1303 PMID 1977660 DOI 10 1101 gad 4 8 1288 Cameron H S Szczepaniak D Weston B W 1995 Expression of human chromosome 19p alpha 1 3 fucosyltransferase genes in normal tissues Alternative splicing polyadenylation and isoforms J Biol Chem 270 20112 20122 PMID 7650030 DOI 10 1074 jbc 270 34 20112 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Elmgren A Rydberg L Larson G 1993 Genotypic heterogeneity among Lewis negative individuals Biochem Biophys Res Commun 196 515 520 PMID 8240322 DOI 10 1006 bbrc 1993 2280 Elmgren A Boerjeson C Svensson L Rydberg L Larson G 1996 DNA sequencing and screening for point mutations in the human Lewis FUT3 gene enables molecular genotyping of the human Lewis blood group system Vox Sang 70 97 103 PMID 8801770 DOI 10 1111 j 1423 0410 1996 tb01300 x Koda Y Kimura H Mekada E 1993 Analysis of Lewis fucosyltransferase genes from the human gastric mucosa of Lewis positive and negative individuals Blood 82 2915 2919 PMID 8219240PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4014 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 13 bereznya 2018 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi