BSG (англ. Basigin (Ok blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 385 амінокислот, а молекулярна маса — 42 200.
BSG | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BSG, 5F7, CD147, EMMPRIN, M6, OK, TCSF, basigin (Ok blood group), EMPRIN, SLC7A11, HAb18G | ||||||||||||||||
Зовнішні ІД | OMIM: 109480 MGI: 88208 HomoloGene: 1308 GeneCards: BSG | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 0.57 – 0.58 Mb | Хр. 10: 79.54 – 79.55 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAAALFVLLG | FALLGTHGAS | GAAGFVQAPL | SQQRWVGGSV | ELHCEAVGSP | ||||
VPEIQWWFEG | QGPNDTCSQL | WDGARLDRVH | IHATYHQHAA | STISIDTLVE | ||||
EDTGTYECRA | SNDPDRNHLT | RAPRVKWVRA | QAVVLVLEPG | TVFTTVEDLG | ||||
SKILLTCSLN | DSATEVTGHR | WLKGGVVLKE | DALPGQKTEF | KVDSDDQWGE | ||||
YSCVFLPEPM | GTANIQLHGP | PRVKAVKSSE | HINEGETAML | VCKSESVPPV | ||||
TDWAWYKITD | SEDKALMNGS | ESRFFVSSSQ | GRSELHIENL | NMEADPGQYR | ||||
CNGTSSKGSD | QAIITLRVRS | HLAALWPFLG | IVAEVLVLVT | IIFIYEKRRK | ||||
PEDVLDDDDA | GSAPLKSSGQ | HQNDKGKNVR | QRNSS |
Білок має сайт для зв'язування з лектинами. Локалізований у клітинній мембрані, мембрані.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Nabeshima K., Lane W.S., Biswas C. (1991). Partial sequencing and characterization of the tumor cell-derived collagenase stimulatory factor. Arch. Biochem. Biophys. 285: 90—96. PMID 1846736 DOI:10.1016/0003-9861(91)90332-D
- Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat. Biotechnol. 21: 660—666. PMID 12754519 DOI:10.1038/nbt827
- Manoharan C., Wilson M.C., Sessions R.B., Halestrap A.P. (2006). The role of charged residues in the transmembrane helices of monocarboxylate transporter 1 and its ancillary protein basigin in determining plasma membrane expression and catalytic activity. Mol. Membr. Biol. 23: 486—498. PMID 17127621 DOI:10.1080/09687860600841967
- Miyauchi T., Masuzawa Y., Muramatsu T. (1991). The basigin group of the immunoglobulin superfamily: complete conservation of a segment in and around transmembrane domains of human and mouse basigin and chicken HT7 antigen. J. Biochem. 110: 770—774. PMID 1783610
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 17 червня 2017. Процитовано 21 серпня 2017.
- (англ.) . Архів оригіналу за 16 серпня 2017. Процитовано 21 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BSG angl Basigin Ok blood group bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 385 aminokislot a molekulyarna masa 42 200 BSGNayavni strukturiPDBPoshuk ortologiv A0A087X2B5 PDBe A0A087X2B5 RCSB Spisok kodiv PDB4U0Q 3B5H 3I84 3I85 3QQN 3QR2IdentifikatoriSimvoliBSG 5F7 CD147 EMMPRIN M6 OK TCSF basigin Ok blood group EMPRIN SLC7A11 HAb18GZovnishni ID OMIM 109480 MGI 88208 HomoloGene 1308 GeneCards BSGOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding mannose binding carbohydrate binding monocarboxylic acid transmembrane transporter activity cadherin binding cell cell adhesion mediator activityKlitinna komponenta integral component of membrane membrana focal adhesion Melanosoma Golgi membrane klitinna membrana integral component of plasma membrane acrosomal membrane mitohondriya membrane raft Sarkolema ekzosoma vnutrishnoklitinna membranna organela aksonBiologichnij proces response to peptide hormone extracellular matrix disassembly extracellular matrix organization odontogenesis of dentin containing tooth cell surface receptor signaling pathway decidualization pyruvate metabolic process response to mercury ion response to cAMP embryo implantation leukocyte migration monocarboxylic acid transport protein localization to plasma membrane homophilic cell adhesion via plasma membrane adhesion molecules axon guidance dendrite self avoidanceDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez682 12215Ensembl ENSG00000172270 ENSMUSG00000023175UniProt P35613 P18572RefSeq mRNK NM 001728 NM 198589 NM 198590 NM 198591 NM 001322243NM 001077184 NM 009768RefSeq bilok NP 001309172 NP 001719 NP 940991 NP 940992 NP 940993NP 001070652 NP 033898Lokus UCSC Hr 19 0 57 0 58 MbHr 10 79 54 79 55 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSP VPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVE EDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE YSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Bilok maye sajt dlya zv yazuvannya z lektinami Lokalizovanij u klitinnij membrani membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Nabeshima K Lane W S Biswas C 1991 Partial sequencing and characterization of the tumor cell derived collagenase stimulatory factor Arch Biochem Biophys 285 90 96 PMID 1846736 DOI 10 1016 0003 9861 91 90332 D Zhang H Li X J Martin D B Aebersold R 2003 Identification and quantification of N linked glycoproteins using hydrazide chemistry stable isotope labeling and mass spectrometry Nat Biotechnol 21 660 666 PMID 12754519 DOI 10 1038 nbt827 Manoharan C Wilson M C Sessions R B Halestrap A P 2006 The role of charged residues in the transmembrane helices of monocarboxylate transporter 1 and its ancillary protein basigin in determining plasma membrane expression and catalytic activity Mol Membr Biol 23 486 498 PMID 17127621 DOI 10 1080 09687860600841967 Miyauchi T Masuzawa Y Muramatsu T 1991 The basigin group of the immunoglobulin superfamily complete conservation of a segment in and around transmembrane domains of human and mouse basigin and chicken HT7 antigen J Biochem 110 770 774 PMID 1783610PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 17 chervnya 2017 Procitovano 21 serpnya 2017 angl Arhiv originalu za 16 serpnya 2017 Procitovano 21 serpnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi